Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Preprotein translocase subunit SecE (secE)

This Recombinant Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

P0A2D4

Expression Region

1-127

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTEAQGSGRGLEAMKWIVVAILLIVAIVGNYLYRDMMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM1 Recombinant Rabbit Monoclonal Antibody [JE55-21]
ET7110-99 100 µL

PDLIM1 Recombinant Rabbit Monoclonal Antibody [JE55-21]

Sign In for Pricing
View Details
KCNK9 (NM_016601) Human Over-expression Lysate
LY402572 100 µg

KCNK9 (NM_016601) Human Over-expression Lysate

Sign In for Pricing
View Details
Volasertib
TRC-V575180-25MG 25 mg

Volasertib

Sign In for Pricing
View Details
FITC Anti-Mouse FcεRIα Antibody[MAR-1]
E-AB-F1188C-01 50 Tests

FITC Anti-Mouse FcεRIα Antibody[MAR-1]

Sign In for Pricing
View Details
FITC Anti-Mouse FcεRIα Antibody[MAR-1]
E-AB-F1188C-02 100 Tests

FITC Anti-Mouse FcεRIα Antibody[MAR-1]

Sign In for Pricing
View Details
FITC Anti-Mouse FcεRIα Antibody[MAR-1]
E-AB-F1188C-03 2x 100 Tests

FITC Anti-Mouse FcεRIα Antibody[MAR-1]

Sign In for Pricing
View Details