Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Brain protein 44 (BRP44)

This Recombinant Pongo abelii Brain protein 44 (BRP44) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Brain protein 44

UniProt

Q5R4Z3

Expression Region

1-127

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKRGLVCAGLADM ARPAEKLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQE LKAKAHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETM1 CRISPRa sgRNA lentivector (set of three targets)(Human)
19523121 3x 1.0µg DNA

ETM1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Lentiviral human MIEN1 shRNA (UAS) - Lentiviral human MIEN1 shRNA (UAS, RFP) (100)
GTR15311859 1 Vial

Lentiviral human MIEN1 shRNA (UAS) - Lentiviral human MIEN1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit K (nuoK)
orb2934455-01 20 µg

Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit K (nuoK)
orb2934455-02 100 µg

Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
PMPCA sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37071111 3x 1.0 µg

PMPCA sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ZNF114 Protein Vector (Human) (pPB-N-His)
PV060026 500 ng

ZNF114 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details