Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Brain protein 44 (BRP44)

This Recombinant Pongo abelii Brain protein 44 (BRP44) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Brain protein 44

UniProt

Q5R4Z3

Expression Region

1-127

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKRGLVCAGLADM ARPAEKLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQE LKAKAHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP-11 Double Nickase Plasmid (m2)
sc-430361-NIC-2 20 µg

PARP-11 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
HP1β Antibody [K15D8]
C19620-50uL 50 μL

HP1β Antibody [K15D8]

Sign In for Pricing
View Details
TMEM189-UBE2V1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2812208 1.0 µg DNA

TMEM189-UBE2V1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NucleoMag 96 Plant
MN 744400.4 4x 96 Preparations

NucleoMag 96 Plant

Sign In for Pricing
View Details
NHE1 (Na, H Exchanger Isoform) (AP) discontinued
N2015-02-AP 100 µL

NHE1 (Na, H Exchanger Isoform) (AP) discontinued

Sign In for Pricing
View Details
2-Chloro-1-iodo-3- (trifluoromethyl) benzene
PC1023592 1 Each

2-Chloro-1-iodo-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details