Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain protein 44 (Brp44)

This Recombinant Mouse Brain protein 44 (Brp44) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Brain protein 44

UniProt

Q9D023

Expression Region

1-127

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQE LKSKGIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E12]
TA500213BM 100 µL

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E12]

Sign In for Pricing
View Details
Lumiflavin
TRC-L473900-5MG 5 mg

Lumiflavin

Sign In for Pricing
View Details
Amplite® Fluorimetric Ascorbic Acid Assay Kit
13835-AAT 200 Tests

Amplite® Fluorimetric Ascorbic Acid Assay Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS701601 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF405S conjugate, 0.1mg/mL
BNC042340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colony Spreader BCLC-103
BCLC-103 1 Unit

Colony Spreader BCLC-103

Sign In for Pricing
View Details