Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Brain protein 44 (Brp44)

This Recombinant Mouse Brain protein 44 (Brp44) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Brain protein 44

UniProt

Q9D023

Expression Region

1-127

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQE LKSKGIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC4F Human qPCR Primer Pair (NM_173535)
HP218353 200 Reactions

CLEC4F Human qPCR Primer Pair (NM_173535)

Sign In for Pricing
View Details
USP21 Rabbit Polyclonal Antibody
TA369796 100 µL

USP21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD42a (GP9) (NM_000174) Human Recombinant Protein
TP306597 20 µg

CD42a (GP9) (NM_000174) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human MMP-3 Protein (His Tag)
PKSH033591-01 10 µg

Recombinant Human MMP-3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MMP-3 Protein (His Tag)
PKSH033591-02 50 µg

Recombinant Human MMP-3 Protein (His Tag)

Sign In for Pricing
View Details
2-(2-Aminoethylamino)ethanol
TRC-A608990-10G 10 g

2-(2-Aminoethylamino)ethanol

Sign In for Pricing
View Details