Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6) spans the amino acid sequence from region 2-128.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17, NADH-ubiquinone oxidoreductase B17 subunit

UniProt

Q0MQE0

Expression Region

2-128

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POK2 Rabbit Polyclonal Antibody
JOT-AP04213-01 20 µL

POK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POK2 Rabbit Polyclonal Antibody
JOT-AP04213-02 50 μL

POK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POK2 Rabbit Polyclonal Antibody
JOT-AP04213-03 100 µL

POK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Paox Antibody, Biotin conjugated
CSB-PA804896LD01MO-01 50 µg

Paox Antibody, Biotin conjugated

Sign In for Pricing
View Details
Paox Antibody, Biotin conjugated
CSB-PA804896LD01MO-02 100 µg

Paox Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Monoclonal UCH-L1/PGP9.5 Antibody (rUCHL1/8133) [Alexa Fluor 532]
NBP3-21025AF532 0.1 mL

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (rUCHL1/8133) [Alexa Fluor 532]

Sign In for Pricing
View Details