Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

This Recombinant Pig NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6) spans the amino acid sequence from region 2-128.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17, NADH-ubiquinone oxidoreductase B17 subunit

UniProt

Q29259

Expression Region

2-128

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGYTPDEKLRLQQLRELRRRWLKDQELSPREPLLPPRRVWPMEQFWNKFLQDGAPWKNVI YKTYRHSIFAVTHVLIPVWIIHYYLKYHVTAKPYTVVERKPRIFPGDTILXTGEVIPLIE GFPXQPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL
BNC470844-500 1x 500 µL

Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF594 conjugate, 0.1mg/mL
BNC942298-500 1x 500 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL
BNC680812-100 1x 100 µL

Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF647 conjugate, 0.1mg/mL
BNC470488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details