Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1491 (MJ1491)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1491 (MJ1491) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1491

UniProt

Q58886

Expression Region

1-127

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYMVSFDQERMLKPAVIGGIINGILGAICCLCYVIGGAVAAHLYVNAGGICDYENCGLV GAISGVIGGVIASILSFLFMSAYLSALGLKAAMFTGASFIIGFITAIIFGAILGAVGGVI YVVIKNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB504153 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CD3e (RIV9), Biotin conjugate, 0.1mg/mL
BNCB0322-500 1x 500 µL

CD3e (RIV9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF640R conjugate, 0.1mg/mL
BNC401761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF423 Antibody
KC-3330-01 50 μL

ZNF423 Antibody

Sign In for Pricing
View Details
ZNF423 Antibody
KC-3330-02 100 µL

ZNF423 Antibody

Sign In for Pricing
View Details
ZNF423 Antibody
KC-3330-03 1 mL

ZNF423 Antibody

Sign In for Pricing
View Details