Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Legionella pneumophila subsp. pneumophila Large-conductance mechanosensitive channel (mscL)

This Recombinant Legionella pneumophila subsp. pneumophila Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q5ZSH7

Expression Region

1-127

Origin

Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLKEFKEFAMRGNVMDLAVAVVMGVAFNKIVTALVDGIIMPCVGLLLGGINIAGLSFT VGDVQIKWGNFLQNVIDFIIVAFAIFVLIKLINLLQRKKANEPEPVTPEIQLLTEIRDLL ARNSSKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL
BNC040809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF488A conjugate, 0.1mg/mL
BNC881924-500 1x 500 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF405S conjugate, 0.1mg/mL
BNC041009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details