Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit C (frdC)

This Recombinant Fumarate reductase subunit C (frdC) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Fumarate reductase subunit C

UniProt

Q87KY2

Expression Region

1-127

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNRKPYVREVKRTWWKNHPFYRFYMLREATVLPLILFTLFLTFGLGCLVKGPEAWQGWL AFMANPIVVAINIVALLGSLFHAQTFFSMMPQVMPIRLKGKPVDKKIIVLTQWAAVAFIS LIVLIVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details