Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

This Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6) spans the amino acid sequence from region 2-128.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17, NADH-ubiquinone oxidoreductase B17 subunit

UniProt

O95139

Expression Region

2-128

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF405S conjugate, 0.1mg/mL
BNC040887-100 1x 100 µL

Cytochrome C (CTC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF568 conjugate, 0.1mg/mL
BNC680844-500 1x 500 µL

Cytokeratin 10 (KRT10/844), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF594 conjugate, 0.1mg/mL
BNC942501-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2501), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF594 conjugate, 0.1mg/mL
BNC941815-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details