Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chondrus crispus Succinate dehydrogenase cytochrome b560 subunit (SDH3)

This Recombinant Chondrus crispus Succinate dehydrogenase cytochrome b560 subunit (SDH3) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Succinate dehydrogenase cytochrome b560 subunit, Succinate dehydrogenase, subunit III

UniProt

P48934

Expression Region

1-127

Origin

Chondrus crispus (Carragheen moss) (Irish moss)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIKFKISNRPIAPHLLVYTPQLSSLFSIWHRISGVGLAFFFTTFLIFIRIILSSNFACN LLTLISFEISQWIIIYFNLFILLFLFYHLFNGTRHIIWDFGFLLDIKYLSKFSLFLLVSL SLILIFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL
BNC881960-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF640R conjugate, 0.1mg/mL
BNC402598-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL
BNC882868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details