Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC)

This Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized protein ywnC

UniProt

P71038

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSA REAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLF SDTYSTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TULA/STS-2 Antibody [mFluor Violet 450 SE]
NBP3-00200MFV450 0.1 mL

Rabbit Polyclonal TULA/STS-2 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human SLC5A2 Protein Lysate 20ug
IHUSLC5A2PLLY20UG 20 µg

Human SLC5A2 Protein Lysate 20ug

Sign In for Pricing
View Details
Anti-PD-1 Antibody (9Z376)
TMAY-03117 100 µL

Anti-PD-1 Antibody (9Z376)

Sign In for Pricing
View Details
ELISA Kit For Angiotensin-converting enzyme 2
E1886h 96 Tests

ELISA Kit For Angiotensin-converting enzyme 2

Sign In for Pricing
View Details
Lentiviral mouse Inip shRNA (UAS) - Lentiviral mouse Inip shRNA (UAS, RFP) (25)
GTR15265487 1 Vial

Lentiviral mouse Inip shRNA (UAS) - Lentiviral mouse Inip shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Methenamine sliver stain kit
HS2009-01 10ml/kit

Methenamine sliver stain kit

Sign In for Pricing
View Details