Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC)

This Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized protein ywnC

UniProt

P71038

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSA REAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLF SDTYSTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium hydrogen oxalate
orb2939828-01 100 g

Potassium hydrogen oxalate

Sign In for Pricing
View Details
Potassium hydrogen oxalate
orb2939828-02 500 g

Potassium hydrogen oxalate

Sign In for Pricing
View Details
Human C6 ELISA Kit
orb564748-01 48 Tests

Human C6 ELISA Kit

Sign In for Pricing
View Details
Human C6 ELISA Kit
orb564748-02 96 Tests

Human C6 ELISA Kit

Sign In for Pricing
View Details
ATG3 Antibody
CSB-PA914063-01 50 μL

ATG3 Antibody

Sign In for Pricing
View Details
ATG3 Antibody
CSB-PA914063-02 100 µL

ATG3 Antibody

Sign In for Pricing
View Details