Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC)

This Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized protein ywnC

UniProt

P71038

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSA REAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLF SDTYSTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Cry j1 IgG1 Monoclonal Antibody (mAb), Clone P1-8
7117 1 mg/mL - 0.1 mL

Mouse Anti-Cry j1 IgG1 Monoclonal Antibody (mAb), Clone P1-8

Sign In for Pricing
View Details
BEST1 (Bestrophin 1, ARB, BMD, BEST, RP50, VMD2, TU15B) (MaxLight 650)
MBS6408486-01 0.1 mL

BEST1 (Bestrophin 1, ARB, BMD, BEST, RP50, VMD2, TU15B) (MaxLight 650)

Sign In for Pricing
View Details
BEST1 (Bestrophin 1, ARB, BMD, BEST, RP50, VMD2, TU15B) (MaxLight 650)
MBS6408486-02 5x 0.1 mL

BEST1 (Bestrophin 1, ARB, BMD, BEST, RP50, VMD2, TU15B) (MaxLight 650)

Sign In for Pricing
View Details
Mmu-miR-669i antagomir
HY-RI03472A-01 5 nmol

Mmu-miR-669i antagomir

Sign In for Pricing
View Details
Mmu-miR-669i antagomir
HY-RI03472A-02 20 nmol

Mmu-miR-669i antagomir

Sign In for Pricing
View Details
Adenovirus, Hexon (MaxLight 405) discontinued
A0880-04K-ML405 100 µL

Adenovirus, Hexon (MaxLight 405) discontinued

Sign In for Pricing
View Details