Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC)

This Recombinant Bacillus subtilis Uncharacterized protein ywnC (ywnC) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized protein ywnC

UniProt

P71038

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSA REAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLF SDTYSTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPS2 (NM_002765) Human Tagged ORF Clone
RG206052 10 µg

PRPS2 (NM_002765) Human Tagged ORF Clone

Sign In for Pricing
View Details
GLIS3 CRISPR Knock Out 293T Cell Line (Human)
21608141 1x 10^6 Cells / 1.0 mL

GLIS3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse Tmed4 qPCR Primer Pair
QM07758S 200 Tests

Mouse Tmed4 qPCR Primer Pair

Sign In for Pricing
View Details
mmu-miR-148a-3p miRNA Inhibitor
MBS8295489-01 10 nmol

mmu-miR-148a-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-148a-3p miRNA Inhibitor
MBS8295489-02 20 nmol

mmu-miR-148a-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-148a-3p miRNA Inhibitor
MBS8295489-03 5x 20 nmol

mmu-miR-148a-3p miRNA Inhibitor

Sign In for Pricing
View Details