Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Preprotein translocase subunit SecE (secE)

This Recombinant Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

P0AG97

Expression Region

1-127

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RIZ1 Protein - (Dry Ice)
H00007799-Q01-25ug 25 µg

Recombinant Human RIZ1 Protein - (Dry Ice)

Sign In for Pricing
View Details
CD45 (F10-89-4) : m-IgGκ BP-HRP Bundle
sc-534024 1 Kit

CD45 (F10-89-4) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Rabbit Polyclonal GFER/ALR Antibody [Alexa Fluor 647]
NBP2-97019AF647 0.1 mL

Rabbit Polyclonal GFER/ALR Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
1- (2-Furyl) ethanamine
FF116689-01 250 mg

1- (2-Furyl) ethanamine

Sign In for Pricing
View Details
1- (2-Furyl) ethanamine
FF116689-02 500 mg

1- (2-Furyl) ethanamine

Sign In for Pricing
View Details
1- (2-Furyl) ethanamine
FF116689-03 1000 mg

1- (2-Furyl) ethanamine

Sign In for Pricing
View Details