Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Preprotein translocase subunit SecE (secE)

This Recombinant Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

P0AG98

Expression Region

1-127

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acyclovir Monophosphate
TRC-A192500-25MG 25 mg

Acyclovir Monophosphate

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Bovine IgG, Fc Specific Antibody
RAF-412-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Bovine IgG, Fc Specific Antibody

Sign In for Pricing
View Details
CAmLG (NM_001745) Human Recombinant Protein
TP318292M 100 µg

CAmLG (NM_001745) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS703598 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF568 conjugate, 0.1mg/mL
BNC682894-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®568 Succinimidyl Ester
#92131 1x 1 µmol

CF®568 Succinimidyl Ester

Sign In for Pricing
View Details