Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Preprotein translocase subunit SecE (secE)

This Recombinant Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

P0AG98

Expression Region

1-127

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pergafast 201
TRC-P287180-500MG 500 mg

Pergafast 201

Sign In for Pricing
View Details
LGR5 Mouse Monoclonal Antibody [Clone ID: OTI3F1]
CF808748 100 µg

LGR5 Mouse Monoclonal Antibody [Clone ID: OTI3F1]

Sign In for Pricing
View Details
Trappc6b (NM_030057) Mouse Tagged ORF Clone
MG201206 10 µg

Trappc6b (NM_030057) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sodium Dichromate Dihydrate
TRC-S615250-5G 5 g

Sodium Dichromate Dihydrate

Sign In for Pricing
View Details
2-Chloropropane
TRC-C379205-50ML 50 mL

2-Chloropropane

Sign In for Pricing
View Details
Protein Kinase D2 Recombinant Rabbit Monoclonal Antibody [JU08-33]
ET7106-87 100 µL

Protein Kinase D2 Recombinant Rabbit Monoclonal Antibody [JU08-33]

Sign In for Pricing
View Details