Recombinant Chlorophyll a-b binding protein of LHCII type 1
This Recombinant Chlorophyll a-b binding protein of LHCII type 1 spans the amino acid sequence from region 1-127.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein of LHCII type 1, Chlorophyll a-b binding protein of LHCII type I, CAB, LHCP
UniProt
P12327
Expression Region
1-127
Origin
Euglena gracilis
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
VVQALIHAKSLLAILATQVLLMGAVEGYRAGNTAPGQFGEDLDRLYPGGPFDPLGLADDP DTFPELKVKEIKNGRLAMSGMLGFYAQAIVTGEGPVENWLYHLQDPSAHNGLTALVTQFA PTPVALL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040008-500 1x 500 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details