Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Movement protein TGB2 (ORF3)

This Recombinant Movement protein TGB2 (ORF3) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Movement protein TGB2, 12 kDa protein, Triple gene block 2 protein, TGBp2

UniProt

P22170

Expression Region

1-127

Origin

Foxtail mosaic virus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLSHGTGAPAISTPLTLRPPPDNTKAILTIAIGIAASLVFFMLTRNNLPHVGDNIHSLP HGGSYIDGTKSINYRPPASRYPSSNLLAFAPPILAAVLFFLTQPYLATRRSRCVRCFVVH GACTNHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC (F4/1)
sc-65218 100 µg/mL

FITC (F4/1)

Sign In for Pricing
View Details
Guinea pig Transcription factor MafB (MAFB) ELISA Kit
MBS7239780-01 48 Well

Guinea pig Transcription factor MafB (MAFB) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transcription factor MafB (MAFB) ELISA Kit
MBS7239780-02 96 Well

Guinea pig Transcription factor MafB (MAFB) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transcription factor MafB (MAFB) ELISA Kit
MBS7239780-03 5x 96 Well

Guinea pig Transcription factor MafB (MAFB) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transcription factor MafB (MAFB) ELISA Kit
MBS7239780-04 10x 96 Well

Guinea pig Transcription factor MafB (MAFB) ELISA Kit

Sign In for Pricing
View Details
NP1 (Nptx1) Antibody Blocking peptide
orb1446788 500 µg

NP1 (Nptx1) Antibody Blocking peptide

Sign In for Pricing
View Details