Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Movement protein TGB2 (ORF3)

This Recombinant Movement protein TGB2 (ORF3) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Movement protein TGB2, 12 kDa protein, Triple gene block 2 protein, TGBp2

UniProt

P22170

Expression Region

1-127

Origin

Foxtail mosaic virus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLSHGTGAPAISTPLTLRPPPDNTKAILTIAIGIAASLVFFMLTRNNLPHVGDNIHSLP HGGSYIDGTKSINYRPPASRYPSSNLLAFAPPILAAVLFFLTQPYLATRRSRCVRCFVVH GACTNHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Glutamate receptor-interacting protein 1 (Grip1) , partial
MBS1312133 Inquire

Recombinant Mouse Glutamate receptor-interacting protein 1 (Grip1) , partial

Sign In for Pricing
View Details
Versilon C-210-A, 4.80 x 0.80 mm, PU=30 m
1214636 30PK

Versilon C-210-A, 4.80 x 0.80 mm, PU=30 m

Sign In for Pricing
View Details
Rabbit Polyclonal HIPK3 Antibody [CoraFluor 1]
NBP2-24521CL1 0.1 mL

Rabbit Polyclonal HIPK3 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
MR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV699037 1.0 µg DNA

MR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human Haptoglobin Related Protein (HPR)
RPU41796-01 50 µg

Recombinant Human Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
Recombinant Human Haptoglobin Related Protein (HPR)
RPU41796-02 100 µg

Recombinant Human Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details