Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus succinogenes Large-conductance mechanosensitive channel (mscL)

This Recombinant Actinobacillus succinogenes Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6VKX7

Expression Region

1-128

Origin

Actinobacillus succinogenes (strain ATCC 55618 / 130Z)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVGDVVMPVLGILTGGVDFKDMKMV LAEAVGETPAVTLNYGMFIQNVFDFIIIAFAIFLMIKAINKLKKPAEEAPKGPSQEELLA EIRDLLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF647 conjugate, 0.1mg/mL
BNC471484-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF740 conjugate, 0.1mg/mL
BNC740718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF488A conjugate, 0.1mg/mL
BNC880275-500 1x 500 µL

C-Myc (MYC275), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details