Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) spans the amino acid sequence from region 2-129.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, Complex I-B15, CI-B15, NADH-ubiquinone oxidoreductase B15 subunit

UniProt

Q0MQD4

Expression Region

2-129

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SYPL2 Antibody
NBP1-77362 0.1 mg

Rabbit Polyclonal SYPL2 Antibody

Sign In for Pricing
View Details
CASPR Recombinant Antibody, APC Conjugated
bsm-61584R-APC-01 20 µL

CASPR Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
CASPR Recombinant Antibody, APC Conjugated
bsm-61584R-APC-02 100 µL

CASPR Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Human CNGA3 Protein - (Dry Ice)
H00001261-P01-25ug 25 µg

Recombinant Human CNGA3 Protein - (Dry Ice)

Sign In for Pricing
View Details
Piperophos
MBS5775691 Inquire

Piperophos

Sign In for Pricing
View Details
Rabbit Polyclonal CBLB Antibody
NBP1-49920 0.1 mL

Rabbit Polyclonal CBLB Antibody

Sign In for Pricing
View Details