Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1310 (MJ1310)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1310 (MJ1310) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1310

UniProt

Q58706

Expression Region

1-128

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMINYLVNRMDFQMASFITSGLLVIIGLYGVFFVDNVLKKIIALEILGSGVNLALIAIG YNGGTIPIKLPGVSVEVFAKESAYPLTHALVLTNIVIEASMLAVMLGVSIILYKKYKTLR SSVILKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dichloroquinoline
TRC-D436225-5G 5 g

2,4-Dichloroquinoline

Sign In for Pricing
View Details
Tivozanib-13CD3
TRC-T388331-25MG 25 mg

Tivozanib-13CD3

Sign In for Pricing
View Details
Recombinant Mouse Siglec-2/CD22 Protein (His Tag)
PKSM040329 100 µg

Recombinant Mouse Siglec-2/CD22 Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS507706 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Goat IgG (H&L) Antibody Fluorescein Conjugated
TA397627 1 mg

Goat IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
Maltose Binding Protein Recombinant Rabbit Monoclonal Antibody [SR41-04]
ET1602-46 100 µL

Maltose Binding Protein Recombinant Rabbit Monoclonal Antibody [SR41-04]

Sign In for Pricing
View Details