Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1310 (MJ1310)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1310 (MJ1310) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1310

UniProt

Q58706

Expression Region

1-128

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMINYLVNRMDFQMASFITSGLLVIIGLYGVFFVDNVLKKIIALEILGSGVNLALIAIG YNGGTIPIKLPGVSVEVFAKESAYPLTHALVLTNIVIEASMLAVMLGVSIILYKKYKTLR SSVILKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 488 Anti-human CD22 Antibody *HIB22*
10220050-AAT 100 Tests

IFluor® 488 Anti-human CD22 Antibody *HIB22*

Sign In for Pricing
View Details
3-(3-Chloropropyl)-1H-pyrrolo[2,1-c][1,4]oxazin-1-one
TRC-C377625-500MG 500 mg

3-(3-Chloropropyl)-1H-pyrrolo[2,1-c][1,4]oxazin-1-one

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624712 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
DNAJC8 (NM_014280) Human Recombinant Protein
TP307697 20 µg

DNAJC8 (NM_014280) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS503207 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS804099 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details