Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus viridis viridis Cytochrome b (MT-CYB)

This Recombinant Crotalus viridis viridis Cytochrome b (MT-CYB) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

Q95776

Expression Region

1-128

Origin

Crotalus viridis viridis (Prairie rattlesnake)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQHLLTMFNLLPVGXNISTWWNFGSMLLSCLTIQIITGFFLAIHYTANINMAFSSIMH ISRDVPYGWIMQNTHAIGXSLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLITLMATAS XXMCYHDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-100 1x 100 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL
BNC740812-100 1x 100 µL

Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL
BNC942385-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF740 conjugate, 0.1mg/mL
BNC742897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details