Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4)
This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4) spans the amino acid sequence from region 2-129.
Product Specifications
Product Name Alternative
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, Complex I-B15, CI-B15, NADH-ubiquinone oxidoreductase B15 subunit
UniProt
Q9CQC7
Expression Region
2-129
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIE DPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKL DRKFNISY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A0882-73A-AP 200 µL
AK7, CT (Putative Adenylate Kinase 7) (AP) discontinued
Sign In for Pricing
View Details 
123366-ML490 100 µL
ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII, PP4, ENX2, ANX5, Annexin V, ) (MaxLight 490)
Sign In for Pricing
View Details