Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4)

This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4) spans the amino acid sequence from region 2-129.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, Complex I-B15, CI-B15, NADH-ubiquinone oxidoreductase B15 subunit

UniProt

Q9CQC7

Expression Region

2-129

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIE DPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKL DRKFNISY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idazoxan hydrochloride
280388-01 50 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
Idazoxan hydrochloride
280388-02 100 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
Idazoxan hydrochloride
280388-03 250 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
Idazoxan hydrochloride
280388-04 500 mg

Idazoxan hydrochloride

Sign In for Pricing
View Details
Idazoxan hydrochloride
280388-05 1 g

Idazoxan hydrochloride

Sign In for Pricing
View Details
Anti-AKT2 Antibody Picoband® (Dylight488 Conjugate)
PB9043-Dylight488 100 µg

Anti-AKT2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details