Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4)

This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Ndufb4) spans the amino acid sequence from region 2-129.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, Complex I-B15, CI-B15, NADH-ubiquinone oxidoreductase B15 subunit

UniProt

Q9CQC7

Expression Region

2-129

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIE DPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKL DRKFNISY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHEB (GTP-binding Protein Rheb, Ras Homolog Enriched in Brain, RHEB2, MGC111559) (FITC)
132550-FITC 100 µL

RHEB (GTP-binding Protein Rheb, Ras Homolog Enriched in Brain, RHEB2, MGC111559) (FITC)

Sign In for Pricing
View Details
Tweezers 119SA SS blunt 150mm
INS2010 1 Each

Tweezers 119SA SS blunt 150mm

Sign In for Pricing
View Details
Harmalacidine
T125160-01 1 mg

Harmalacidine

Sign In for Pricing
View Details
Harmalacidine
T125160-02 5 mg

Harmalacidine

Sign In for Pricing
View Details
Olr1016 sgRNA CRISPR Lentivector set (Rat)
K7197101 3x 1.0 µg

Olr1016 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Buprenorphine (BUP) Surface Test Panel
DBU-X14 25 Tests

Buprenorphine (BUP) Surface Test Panel

Sign In for Pricing
View Details