Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

This Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) spans the amino acid sequence from region 2-129.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, Complex I-B15, CI-B15, NADH-ubiquinone oxidoreductase B15 subunit

UniProt

P48305

Expression Region

2-129

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFPKYEASRLSSLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYYDPSRRGVIE DPALVRWTYARSANIYPNFRPNTKTSLLGALFGIGPLVFWYYVFKTDRDRKEKLIQEGKL DRTFNISY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-100 1x 100 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC909), CF647 conjugate, 0.1mg/mL
BNC470909-500 1x 500 µL

C-Myc (MYC909), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL
BNC471870-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details