Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Non-structural protein 4 (4)

This Recombinant Murine coronavirus Non-structural protein 4 (4) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Non-structural protein 4, ns4, Accessory protein 4

UniProt

P0C5A8

Expression Region

1-128

Origin

Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVLGPKATLAAVFIGPFIVACMLGIGLVYLLQLQVQIFHVKDTIRVTGKPATVSYTTST PVTPSATTLDGTTYTLIRPTSSYTRVYLGTPRGFDYSTFGPKTLDYVTNLNLILILVVHI LLRHCPGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2,2-Diethoxyethyl) pentafluorosulfur
FGA99085-01 50 mg

(2,2-Diethoxyethyl) pentafluorosulfur

Sign In for Pricing
View Details
(2,2-Diethoxyethyl) pentafluorosulfur
FGA99085-02 0.5 g

(2,2-Diethoxyethyl) pentafluorosulfur

Sign In for Pricing
View Details
Human Keratin 19 (KRT19) Protein
abx654105-01 10 µg

Human Keratin 19 (KRT19) Protein

Sign In for Pricing
View Details
Human Keratin 19 (KRT19) Protein
abx654105-02 50 µg

Human Keratin 19 (KRT19) Protein

Sign In for Pricing
View Details
Human Keratin 19 (KRT19) Protein
abx654105-03 100 µg

Human Keratin 19 (KRT19) Protein

Sign In for Pricing
View Details
Human Keratin 19 (KRT19) Protein
abx654105-04 200 µg

Human Keratin 19 (KRT19) Protein

Sign In for Pricing
View Details