Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Non-structural protein 4 (4)

This Recombinant Murine coronavirus Non-structural protein 4 (4) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Non-structural protein 4, ns4, Accessory protein 4

UniProt

P0C5A8

Expression Region

1-128

Origin

Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVLGPKATLAAVFIGPFIVACMLGIGLVYLLQLQVQIFHVKDTIRVTGKPATVSYTTST PVTPSATTLDGTTYTLIRPTSSYTRVYLGTPRGFDYSTFGPKTLDYVTNLNLILILVVHI LLRHCPGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD99 (Cluster Of Differentiation 99) Microsample ELISA Kit
orb2998671-01 48 Tests

Human CD99 (Cluster Of Differentiation 99) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CD99 (Cluster Of Differentiation 99) Microsample ELISA Kit
orb2998671-02 96 Tests

Human CD99 (Cluster Of Differentiation 99) Microsample ELISA Kit

Sign In for Pricing
View Details
Foxe1 Rabbit Polyclonal Antibody (HRP)
orb2130261 100 µL

Foxe1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse PWWP domain-containing protein 2A, Pwwp2a ELISA KIT
ELI-16768m 96 Tests

Mouse PWWP domain-containing protein 2A, Pwwp2a ELISA KIT

Sign In for Pricing
View Details
VARS Protein Vector (Rat) (pPM-C-HA)
49426026 500 ng

VARS Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Boc-Glu (OBzl) -OH
T64333-01 1 mL - 10 mM (in DMSO)

Boc-Glu (OBzl) -OH

Sign In for Pricing
View Details