Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Non-structural protein 4 (4)

This Recombinant Murine coronavirus Non-structural protein 4 (4) spans the amino acid sequence from region 1-128.

Product Specifications

Product Name Alternative

Non-structural protein 4, ns4, Accessory protein 4

UniProt

P0C5A8

Expression Region

1-128

Origin

Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVLGPKATLAAVFIGPFIVACMLGIGLVYLLQLQVQIFHVKDTIRVTGKPATVSYTTST PVTPSATTLDGTTYTLIRPTSSYTRVYLGTPRGFDYSTFGPKTLDYVTNLNLILILVVHI LLRHCPGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3,3-dimethyloxiran-2-yl) (5-hydroxybenzo[b]furan-3-yl) methanone
OR27948 1 Each

(3,3-dimethyloxiran-2-yl) (5-hydroxybenzo[b]furan-3-yl) methanone

Sign In for Pricing
View Details
Olfr1065 Mouse qPCR Primer Pair (NM_146408)
MP209316 200 Reactions

Olfr1065 Mouse qPCR Primer Pair (NM_146408)

Sign In for Pricing
View Details
6-Hydroxy Methaqualone
162148 5 mg

6-Hydroxy Methaqualone

Sign In for Pricing
View Details
TTC39C Rabbit Polyclonal Antibody
orb1174279 100 µg

TTC39C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Serine protease inhibitor Kazal-type 7
AP85196 1 mg

Serine protease inhibitor Kazal-type 7

Sign In for Pricing
View Details
(tert-Butoxycarbonyl) -L-valylglycine 1000mg
A23775-1000 1000 mg

(tert-Butoxycarbonyl) -L-valylglycine 1000mg

Sign In for Pricing
View Details