Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus pleuropneumoniae serotype 3 Large-conductance mechanosensitive channel (mscL)

This Recombinant Actinobacillus pleuropneumoniae serotype 3 Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B0BRR8

Expression Region

1-129

Origin

Actinobacillus pleuropneumoniae serotype 3 (strain JL03)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSILKEFREFAVKGNVVDMAVGVIIGGAFGKIVSSLVSDVVMPPIGWLIGGVDFKDLAIE IAPAKEGAEAVMLKYGAFIQNVFLLGVIAIAADGMGTLINKIKKPAEAAPAEPTAEEKLL TEIRDLLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF640R conjugate, 0.1mg/mL
BNC402250-500 1x 500 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF740 conjugate, 0.1mg/mL
BNC741236-500 1x 500 µL

PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details