Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Uncharacterized protein R853

UniProt

Q5UP28

Expression Region

1-129

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYEDAIDFDDPYLFHSVISPQLNSGLITPRYVLDKVIDKYNKSNTDLLYEVEGYIRQLVW REYSRMLYRYIRKDMMKNYFGNKNRISEIWYTGNTGIEPVDLAISSAFQYGLSTSNFFFI FLYIFTIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHF (NM_001301170) Human Tagged ORF Clone
RG237229 10 µg

SHF (NM_001301170) Human Tagged ORF Clone

Sign In for Pricing
View Details
1,3-Bis(acetylamino)adamantane
TRC-B611510-1G 1 g

1,3-Bis(acetylamino)adamantane

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS506567 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
FRMD5 Rabbit Polyclonal Antibody
TA370949 100 µL

FRMD5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/2986), CF647 conjugate, 0.1mg/mL
BNC472986-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/2986), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL
BNC880759-500 1x 500 µL

Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details