Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Uncharacterized protein R853

UniProt

Q5UP28

Expression Region

1-129

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYEDAIDFDDPYLFHSVISPQLNSGLITPRYVLDKVIDKYNKSNTDLLYEVEGYIRQLVW REYSRMLYRYIRKDMMKNYFGNKNRISEIWYTGNTGIEPVDLAISSAFQYGLSTSNFFFI FLYIFTIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GNT5 (Center) Rabbit Polyclonal Antibody
AP50329PU-N 400 µL

B3GNT5 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3C Rabbit Polyclonal Antibody
TA366203 100 µL

PPP1R3C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD24 Protein (Fc Tag)
PKSH031297 100 µg

Recombinant Human CD24 Protein (Fc Tag)

Sign In for Pricing
View Details
TNK1 Human Gene Knockout Kit (CRISPR)
KN423073 1 Kit

TNK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SynaptoRedTMC1 5x1mg
#70041 5x 1 mg

SynaptoRedTMC1 5x1mg

Sign In for Pricing
View Details
Tgfa Mouse Gene Knockout Kit (CRISPR)
KN517481 1 Kit

Tgfa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details