Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R853 (MIMI_R853) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

Uncharacterized protein R853

UniProt

Q5UP28

Expression Region

1-129

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYEDAIDFDDPYLFHSVISPQLNSGLITPRYVLDKVIDKYNKSNTDLLYEVEGYIRQLVW REYSRMLYRYIRKDMMKNYFGNKNRISEIWYTGNTGIEPVDLAISSAFQYGLSTSNFFFI FLYIFTIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIAH1 (Center) Rabbit Polyclonal Antibody
AP53913PU-N 400 µL

SIAH1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UPP2 (C-term) Rabbit Polyclonal Antibody
AP54478PU-N 400 µL

UPP2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDIPT Human Gene Knockout Kit (CRISPR)
KN400281 1 Kit

CDIPT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS629449 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
N,N’-Di(o-tolyl)-p-phenylenediamine-D13
TRC-D650542-50MG 50 mg

N,N’-Di(o-tolyl)-p-phenylenediamine-D13

Sign In for Pricing
View Details
GBP5 Rabbit Polyclonal Antibody
TA364814 100 µL

GBP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details