Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Thylakoid membrane phosphoprotein 14 kDa, chloroplastic (TMP14)

This Recombinant Arabidopsis thaliana Thylakoid membrane phosphoprotein 14 kDa, chloroplastic (TMP14) spans the amino acid sequence from region 46-174.

Product Specifications

Product Name Alternative

Thylakoid membrane phosphoprotein 14 kDa, chloroplastic

UniProt

Q8LCA1

Expression Region

46-174

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAKATAYCRKIVRNVVTRATTEVGEAPATTTEAETTELPEIVKTAQEAWEKVDDKYAIGS LAFAGVVALWGSAGMISAIDRLPLVPGVLELVGIGYTGWFTYKNLVFKPDREALFEKVKS TYKDILGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-500 1x 500 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF594 conjugate, 0.1mg/mL
BNC942278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL
BNC942939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC401204-500 1x 500 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details