Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Thylakoid membrane phosphoprotein 14 kDa, chloroplastic (TMP14)

This Recombinant Arabidopsis thaliana Thylakoid membrane phosphoprotein 14 kDa, chloroplastic (TMP14) spans the amino acid sequence from region 46-174.

Product Specifications

Product Name Alternative

Thylakoid membrane phosphoprotein 14 kDa, chloroplastic

UniProt

Q8LCA1

Expression Region

46-174

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAKATAYCRKIVRNVVTRATTEVGEAPATTTEAETTELPEIVKTAQEAWEKVDDKYAIGS LAFAGVVALWGSAGMISAIDRLPLVPGVLELVGIGYTGWFTYKNLVFKPDREALFEKVKS TYKDILGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β- Nicotinamide- 8- methylaminoadenine dinucleotide (8-MA-NAD⁺), sodium salt
N 025-01 1 µmol ~ 0.7 mg

β- Nicotinamide- 8- methylaminoadenine dinucleotide (8-MA-NAD⁺), sodium salt

Sign In for Pricing
View Details
Anti-Fruit fly vas Antibody Fluoro488 Conjugated
DZ41154-Fluoro488 200 µL/Vial

Anti-Fruit fly vas Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
APC Anti-Mouse Foxp3 Antibody (3G3)
APC-30111-01 50 Tests

APC Anti-Mouse Foxp3 Antibody (3G3)

Sign In for Pricing
View Details
APC Anti-Mouse Foxp3 Antibody (3G3)
APC-30111-02 100 Tests

APC Anti-Mouse Foxp3 Antibody (3G3)

Sign In for Pricing
View Details
Recombinant Human LYRM7 Protein
E30P8614 20 µg

Recombinant Human LYRM7 Protein

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Probable septum site-determining protein MinC (minC)
MBS1183609-01 0.02 mg (E-Coli)

Recombinant Laribacter hongkongensis Probable septum site-determining protein MinC (minC)

Sign In for Pricing
View Details