Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9 (IRC9)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9 (IRC9) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Putative uncharacterized protein IRC9, Increased recombination centers protein 9

UniProt

P47010

Expression Region

1-130

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMQKASKVNMEVRTTLVTMQATTMSIILALPLVVLIASTLVLSVKGRRIHLATSPIILL LLILFKKGQQARSINFTLSKNKSLFCLTFLNYPFHFITAWCHNDILNKYEFCLFLIFLIR IVITINKVTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY1J Recombinant Protein (Human)
RP086379 100 µg

RBMY1J Recombinant Protein (Human)

Sign In for Pricing
View Details
FKTN Peptide - N-terminal region
MBS3232597-01 0.1 mg

FKTN Peptide - N-terminal region

Sign In for Pricing
View Details
FKTN Peptide - N-terminal region
MBS3232597-02 5x 0.1 mg

FKTN Peptide - N-terminal region

Sign In for Pricing
View Details
ZFPL1 Rabbit Polyclonal Antibody (Cy5)
orb957826 100 µL

ZFPL1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Human HOOK2 (NM_001100176) AAV Particle
RC218533A1V 250 µL

Human HOOK2 (NM_001100176) AAV Particle

Sign In for Pricing
View Details
AMELY Human siRNA Oligo Duplex (Locus ID 266)
SR300182 1 Kit

AMELY Human siRNA Oligo Duplex (Locus ID 266)

Sign In for Pricing
View Details