Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9 (IRC9)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9 (IRC9) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Putative uncharacterized protein IRC9, Increased recombination centers protein 9

UniProt

P47010

Expression Region

1-130

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMQKASKVNMEVRTTLVTMQATTMSIILALPLVVLIASTLVLSVKGRRIHLATSPIILL LLILFKKGQQARSINFTLSKNKSLFCLTFLNYPFHFITAWCHNDILNKYEFCLFLIFLIR IVITINKVTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2L1 Antibody
orb352708-01 50 μL

PKD2L1 Antibody

Sign In for Pricing
View Details
PKD2L1 Antibody
orb352708-02 100 µL

PKD2L1 Antibody

Sign In for Pricing
View Details
CD8 (p32, LEU2)
C2258-94G 100 µg

CD8 (p32, LEU2)

Sign In for Pricing
View Details
SARS-CoV-2 Surrogate Virus Neutralization Test Kit (B.1.617.1/E484Q, L452R)
E55K0703 96 Tests

SARS-CoV-2 Surrogate Virus Neutralization Test Kit (B.1.617.1/E484Q, L452R)

Sign In for Pricing
View Details
Rabbit Monoclonal IFN-alpha/beta R2 Antibody (122) [Alexa Fluor 700]
NBP2-89447AF700 0.1 mL

Rabbit Monoclonal IFN-alpha/beta R2 Antibody (122) [Alexa Fluor 700]

Sign In for Pricing
View Details
Histone Acetyl transferase MYST2 (MYST2) Mouse ELISA Kit
E0463 96 Tests

Histone Acetyl transferase MYST2 (MYST2) Mouse ELISA Kit

Sign In for Pricing
View Details