Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnaporthe oryzae Assembly factor CBP4 (CBP4)

This Recombinant Magnaporthe oryzae Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA-processing protein 4

UniProt

A4RC22

Expression Region

1-130

Origin

Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPKAPNYKLWAKMILGGAGIAVGGPAFVMYISPTEEELFKRYNPDLQKRALESRYERQK EYDDFVTELKKSAKSDKNIWITQQIEAEKKEKLARQMASANAAAEQARMQEEEHAKIEQM RREAGLPPTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIAS2 (185-196) Goat Polyclonal Antibody
AP23730PU-N 100 µg

PIAS2 (185-196) Goat Polyclonal Antibody

Sign In for Pricing
View Details
1,3:2,4-Bis(O-benzylidene)-D-sorbitol
TRC-B535595-10MG 10 mg

1,3:2,4-Bis(O-benzylidene)-D-sorbitol

Sign In for Pricing
View Details
CD40, Mouse (FGK45.5), CF568 conjugate, 0.1mg/mL
BNC682005-500 1x 500 µL

CD40, Mouse (FGK45.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT1 (Ab-727) Antibody
8B7221-AAT 50 µg

STAT1 (Ab-727) Antibody

Sign In for Pricing
View Details
FAS Antibody (Biotin)
KB-8370-01 50 μL

FAS Antibody (Biotin)

Sign In for Pricing
View Details
FAS Antibody (Biotin)
KB-8370-02 100 µL

FAS Antibody (Biotin)

Sign In for Pricing
View Details