Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613)

This Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Uncharacterized protein PM0613

UniProt

Q9CN32

Expression Region

1-130

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFG LNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGA LGSPSSKDQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP11 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61387R-BF405-01 20 µL

BMP11 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
BMP11 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61387R-BF405-02 100 µL

BMP11 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Genesig® Standard kit for K.pneumoniae_capsule-2
Z-Path-K.pneumoniae_cap-2-std 150 Tests

Genesig® Standard kit for K.pneumoniae_capsule-2

Sign In for Pricing
View Details
Antibiotic Assay Medium No. 9 (Polymyxin Base Agar)
52812-01 100 g

Antibiotic Assay Medium No. 9 (Polymyxin Base Agar)

Sign In for Pricing
View Details
Antibiotic Assay Medium No. 9 (Polymyxin Base Agar)
52812-02 500 g

Antibiotic Assay Medium No. 9 (Polymyxin Base Agar)

Sign In for Pricing
View Details
HLA class II DR beta 1 / HLA-DRB1 (N-term) Rabbit Polyclonal Antibody
AP17469PU-N 400 µL

HLA class II DR beta 1 / HLA-DRB1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details