Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613)

This Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Uncharacterized protein PM0613

UniProt

Q9CN32

Expression Region

1-130

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFG LNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGA LGSPSSKDQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 Antibody
V8102SAF-100UG 100 µg

BRCA1 Antibody

Sign In for Pricing
View Details
SEC23IP Protein Vector (Rat) (pPB-N-His)
PV303859 500 ng

SEC23IP Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human NK6 Homeobox Protein 1 (NKX6-1)
RPU53874-01 50 µg

Recombinant Human NK6 Homeobox Protein 1 (NKX6-1)

Sign In for Pricing
View Details
Recombinant Human NK6 Homeobox Protein 1 (NKX6-1)
RPU53874-02 100 µg

Recombinant Human NK6 Homeobox Protein 1 (NKX6-1)

Sign In for Pricing
View Details
Recombinant Human NK6 Homeobox Protein 1 (NKX6-1)
RPU53874-03 1 mg

Recombinant Human NK6 Homeobox Protein 1 (NKX6-1)

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL
BNC882350-500 1x 500 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details