Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613)

This Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Uncharacterized protein PM0613

UniProt

Q9CN32

Expression Region

1-130

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFG LNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGA LGSPSSKDQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEST antibody
70R-18480 50 ul

MEST antibody

Sign In for Pricing
View Details
Human PCBP1 qPCR Primer Pair
QH04573S 200 Tests

Human PCBP1 qPCR Primer Pair

Sign In for Pricing
View Details
ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 405)
MBS6464060-01 0.1 mL

ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 405)

Sign In for Pricing
View Details
ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 405)
MBS6464060-02 5x 0.1 mL

ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Monoclonal SIGNR1/CD209b Antibody (143) [Alexa Fluor 750]
NBP2-90609AF750 0.1 mL

Rabbit Monoclonal SIGNR1/CD209b Antibody (143) [Alexa Fluor 750]

Sign In for Pricing
View Details
AKR1D1 Polyclonal Antibody, HRP Conjugated
A62071-100 100 µL

AKR1D1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details