Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

This Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt

Q9HQ63

Expression Region

1-130

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESYDRGLVADFGRWTEFSAGMWAWVFHKFTGWVLVGYLFTHISVLSTSLQGAQVYNST LSGLESLAIVRLLEVGLLAVAVFHILNGIRLLFVDLGVGLEAQDKSFYASLVLTGVIVVA SVPTFLTGAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB34 Rabbit pAb
E47R13571 100 µL

ZBTB34 Rabbit pAb

Sign In for Pricing
View Details
HSPE1P2 Protein Vector (Human) (pPM-C-His)
PV084996 500 ng

HSPE1P2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SLITRK3 (NM_014926) Human Tagged ORF Clone Lentiviral Particle
RC216455L4V 200 µL

SLITRK3 (NM_014926) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Muc1 Pre-designed siRNA Set A
SI208849A 1 Each

Rat Muc1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cdk2 discontinued
387307 200 µL

Cdk2 discontinued

Sign In for Pricing
View Details
Hydroxyproline ELISA Kit (OKEH02551)
OKEH02551 96 Well

Hydroxyproline ELISA Kit (OKEH02551)

Sign In for Pricing
View Details