Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Barley stripe mosaic virus Movement protein TGB2

This Recombinant Barley stripe mosaic virus Movement protein TGB2 spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Movement protein TGB2, 14 kDa protein, Beta-D protein, Triple gene block 2 protein, TGBp2, Cleaved into the following chain:, 1. TGB2' protein

UniProt

P04869

Expression Region

1-131

Origin

Barley stripe mosaic virus (BSMV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTTVGSRPNKYWPIVAGIGVVGLFAYLIFSNQKHSTESGDNIHKFANGGSYRDGSKSIS YNRNHPFAYGNASSPGMLLPAMLTIIGIISYLWRTRDSVLGDSGGNNSCGEDCQGECLNG HSRRSLLCDIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (B22.1), CF488A conjugate, 0.1mg/mL
BNC881219-100 1x 100 µL

Cytokeratin 8 (B22.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF640R conjugate, 0.1mg/mL
BNC402968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details