Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405 (MJ0405)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405 (MJ0405) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0405

UniProt

Q57848

Expression Region

1-131

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIMITISENSEAKELMPIAQAVHILVNKLPVAMRSKNKPGVRLEKGEVVDTNYEGYVLK VAIEKGEVVRATPIIGPYAGLPVIVAPIKDGDNVLGAIGVVDITAGIFEDIVAISRRPEL YKFLPEDAFPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human USP54 activation kit by CRISPRa
GA115988 1 Kit

Human USP54 activation kit by CRISPRa

Sign In for Pricing
View Details
p-Butyl Ibuprofen Sodium Salt
TRC-B692200-25MG 25 mg

p-Butyl Ibuprofen Sodium Salt

Sign In for Pricing
View Details
ATF1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF807630 100 µg

ATF1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), 0.2mg/mL
BNUB3149-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), 0.2mg/mL

Sign In for Pricing
View Details
Midostaurin-13C6
TRC-M343762-2.5MG 2.5 mg

Midostaurin-13C6

Sign In for Pricing
View Details
3’-Hydroxy Diclofenac
TRC-H825725-25MG 25 mg

3’-Hydroxy Diclofenac

Sign In for Pricing
View Details