Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405 (MJ0405)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405 (MJ0405) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0405

UniProt

Q57848

Expression Region

1-131

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIMITISENSEAKELMPIAQAVHILVNKLPVAMRSKNKPGVRLEKGEVVDTNYEGYVLK VAIEKGEVVRATPIIGPYAGLPVIVAPIKDGDNVLGAIGVVDITAGIFEDIVAISRRPEL YKFLPEDAFPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD36 (NM_001001548) Human Over-expression Lysate
LC424373 20 µg

CD36 (NM_001001548) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS512179 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
5Alpha-Androstane-3Alpha,17Beta-diol-d3
TRC-A637522-2.5MG 2.5 mg

5Alpha-Androstane-3Alpha,17Beta-diol-d3

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Protein A,  30nm
GAP-01-30 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Protein A, 30nm

Sign In for Pricing
View Details
ABLIM2 (NM_001130086) Human Over-expression Lysate
LY427154 100 µg

ABLIM2 (NM_001130086) Human Over-expression Lysate

Sign In for Pricing
View Details
(2R)-2-Amino-3-phenylpropionyl Amide
TRC-A626080-500MG 500 mg

(2R)-2-Amino-3-phenylpropionyl Amide

Sign In for Pricing
View Details