Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405 (MJ0405)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0405 (MJ0405) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0405

UniProt

Q57848

Expression Region

1-131

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIMITISENSEAKELMPIAQAVHILVNKLPVAMRSKNKPGVRLEKGEVVDTNYEGYVLK VAIEKGEVVRATPIIGPYAGLPVIVAPIKDGDNVLGAIGVVDITAGIFEDIVAISRRPEL YKFLPEDAFPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B7-H5/Gi24/VSIR Protein (Fc Tag)
PKSH032903-01 10 µg

Recombinant Human B7-H5/Gi24/VSIR Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human B7-H5/Gi24/VSIR Protein (Fc Tag)
PKSH032903-02 50 µg

Recombinant Human B7-H5/Gi24/VSIR Protein (Fc Tag)

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF594 conjugate, 0.1mg/mL
BNC942883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant FGF1 Antibody
RC-4946-01 50 μL

Recombinant FGF1 Antibody

Sign In for Pricing
View Details
Recombinant FGF1 Antibody
RC-4946-02 100 µL

Recombinant FGF1 Antibody

Sign In for Pricing
View Details
Recombinant FGF1 Antibody
RC-4946-03 1 mL

Recombinant FGF1 Antibody

Sign In for Pricing
View Details